SCOPe 2.06: Domain d5b25c_: 5b25 C:

Lineage for d5b25c_ (5b25 C:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
   multihelical; consists of two different alpha-helical bundles

4. Superfamily a.211.1: HD-domain/PDEase-like [109604] (6 families)

5. Family a.211.1.2: PDEase [48548] (7 proteins)
   Pfam PF00233; multihelical; can be divided into three subdomains

6. Protein automated matches [190370] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187208] (27 PDB entries)

8. Domain d5b25c_: 5b25 C: [312617]
   automated match to d1taza_
   complexed with 4qj, gol, mg, so4, zn

Details for d5b25c_

PDB Entry: 5b25, 1.9 Å

PDB Description: crystal structure of human pde1b with inhibitor 3

PDB Compounds: (C:) Calcium/calmodulin-dependent 3',5'-cyclic nucleotide phosphodiesterase 1B

SCOPe Domain Sequences for d5b25c_:

Sequence; same for both SEQRES and ATOM records:

>d5b25c_ a.211.1.2 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tystavlnclknldlwcfdvfslnqaaddhalrtivfelltrhnlisrfkiptvflmsfl
daletgygkyknpyhnqihaadvtqtvhcfllrtgmvhclseiellaiifaaaihdyeht
gttnsfhiqtksecaivyndrsvlenhhissvfrlmqddemnifinltkdefvelralvi
emvlatdmschfqqvktmktalqqleridkpkalslllhaadishptkqwlvhsrwtkal
meeffrqgdkeaelglpfsplcdrtstlvaqsqigfidfiveptfsvltdvaeksvqpla
gdpnpdvvsfrstwvkriqenkqkwkeraasg

Timeline for d5b25c_:

• d5b25c_ is new in SCOPe 2.06-stable
  
• d5b25c_ appears in SCOPe 2.07
  
• d5b25c_ appears in the current release, SCOPe 2.08