SCOPe 2.06: Domain d5a1ta1: 5a1t A:4-154

Lineage for d5a1ta1 (5a1t A:4-154)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.0: automated matches [191313] (1 protein)
   not a true family

6. Protein automated matches [190069] (239 species)
   not a true protein

7. Species Trichomonas vaginalis [TaxId:5722] [276010] (5 PDB entries)

8. Domain d5a1ta1: 5a1t A:4-154 [312491]
   Other proteins in same PDB: d5a1ta2, d5a1tb2
   automated match to d4uuma1
   complexed with nai, oxm

Details for d5a1ta1

PDB Entry: 5a1t, 1.97 Å

PDB Description: trichomonas vaginalis lactate dehydrogenase in complex with nadh and oxamate

PDB Compounds: (A:) l-lactate dehydrogenase

SCOPe Domain Sequences for d5a1ta1:

Sequence; same for both SEQRES and ATOM records:

>d5a1ta1 c.2.1.0 (A:4-154) automated matches {Trichomonas vaginalis [TaxId: 5722]}
aahvlitgaagqigyilshwiasgelygdrqvylhlldippamnrltaltmeledcafph
lagfvattdpkaafkdidcaflvasmplkpgqvradlissnsvifkntgeylskwakpsv
kvlvignpdntnceiamlhaknlkpenfssl

Timeline for d5a1ta1:

• d5a1ta1 is new in SCOPe 2.06-stable
  
• d5a1ta1 appears in SCOPe 2.07
  
• d5a1ta1 appears in the current release, SCOPe 2.08