| Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
| Fold d.165: Ribosome inactivating proteins (RIP) [56370] (1 superfamily) contains mixed beta-sheet |
Superfamily d.165.1: Ribosome inactivating proteins (RIP) [56371] (3 families) ![]() |
| Family d.165.1.0: automated matches [191615] (1 protein) not a true family |
| Protein automated matches [191124] (8 species) not a true protein |
| Species Bitter gourd (Momordica charantia) [TaxId:3673] [312311] (16 PDB entries) |
| Domain d4za3a_: 4za3 A: [312456] Other proteins in same PDB: d4za3b1, d4za3b2 automated match to d1abra_ complexed with bma, edo, fuc, gol, nag |
PDB Entry: 4za3 (more details), 1.67 Å
SCOPe Domain Sequences for d4za3a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4za3a_ d.165.1.0 (A:) automated matches {Bitter gourd (Momordica charantia) [TaxId: 3673]}
nlslsqsnfsadtyksfiknlrkqltigasygsagipilkhsvpicerfllvdltngdne
titlainvedagfaayraadrsyffqnappiasyviftdtnqnimnfnntfesieivggt
trsetplgimhfeasifhlfvhdenyvptsflvliqmvleaakfkfieqkvihsimdmed
ftpglamlsleenwtqlslqlqaseslngvfgdsvslynsmdepigvdsmyypiltanma
fqlyqcp
Timeline for d4za3a_: