Lineage for d5a19a3 (5a19 A:252-395)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2582825Fold d.130: S-adenosylmethionine synthetase [55972] (1 superfamily)
    duplication: consists of 3 similar intertwined domains
    structural repeat: beta-alpha-beta(2)-alpha-beta; two layers, alpha/beta
  4. 2582826Superfamily d.130.1: S-adenosylmethionine synthetase [55973] (2 families) (S)
  5. 2582960Family d.130.1.0: automated matches [254267] (1 protein)
    not a true family
  6. 2582961Protein automated matches [254617] (15 species)
    not a true protein
  7. 2583085Species Human (Homo sapiens) [TaxId:9606] [255522] (26 PDB entries)
  8. 2583175Domain d5a19a3: 5a19 A:252-395 [312444]
    automated match to d2p02a3
    complexed with edo, k, mg, peg, pg4, ppk

Details for d5a19a3

PDB Entry: 5a19 (more details), 2.34 Å

PDB Description: the structure of mat2a in complex with ppnp.
PDB Compounds: (A:) S-adenosylmethionine synthase isoform type-2

SCOPe Domain Sequences for d5a19a3:

Sequence; same for both SEQRES and ATOM records: (download)

>d5a19a3 d.130.1.0 (A:252-395) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iggpqgdagltgrkiivdtyggwgahgggafsgkdytkvdrsaayaarwvakslvkgglc
rrvlvqvsyaigvshplsisifhygtsqkserelleivkknfdlrpgvivrdldlkkpiy
qrtaayghfgrdsfpwevpkklky

SCOPe Domain Coordinates for d5a19a3:

Click to download the PDB-style file with coordinates for d5a19a3.
(The format of our PDB-style files is described here.)

Timeline for d5a19a3: