![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
![]() | Superfamily c.23.6: Cobalamin (vitamin B12)-binding domain [52242] (1 family) ![]() |
![]() | Family c.23.6.1: Cobalamin (vitamin B12)-binding domain [52243] (5 proteins) |
![]() | Protein Methylmalonyl-CoA mutase beta subunit, C-terminal domain [88719] (1 species) inactive subunit |
![]() | Species Propionibacterium freudenreichii, subsp. shermanii [TaxId:1744] [88720] (8 PDB entries) |
![]() | Domain d7reqb2: 7req B:476-638 [31244] Other proteins in same PDB: d7reqa1, d7reqa2, d7reqb1, d7reqc1, d7reqc2, d7reqd1 complexed with 2cp, b12, gol |
PDB Entry: 7req (more details), 2.2 Å
SCOPe Domain Sequences for d7reqb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d7reqb2 c.23.6.1 (B:476-638) Methylmalonyl-CoA mutase beta subunit, C-terminal domain {Propionibacterium freudenreichii, subsp. shermanii [TaxId: 1744]} tkpfpaaparkglawhrdsevfeqlmdrstsvserpkvflaclgtrrdfggregfsspvw hiagidtpqveggttaeiveafkksgaqvadlcssakvyaqqglevakalkaagakalyl sgafkefgddaaeaeklidgrlfmgmdvvdtlsstldilgvak
Timeline for d7reqb2: