Lineage for d4yy0d_ (4yy0 D:)

  1. Root: SCOPe 2.07
  2. 2643820Class h: Coiled coil proteins [57942] (7 folds)
  3. 2645404Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 2645405Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 2645406Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)
  6. 2645931Protein automated matches [254646] (36 species)
    not a true protein
  7. 2646371Species Unidentified influenza virus [TaxId:119212] [312202] (5 PDB entries)
  8. 2646375Domain d4yy0d_: 4yy0 D: [312382]
    Other proteins in same PDB: d4yy0a_, d4yy0c_, d4yy0e_
    automated match to d3s12b_
    complexed with nag

Details for d4yy0d_

PDB Entry: 4yy0 (more details), 2.59 Å

PDB Description: the structure of hemagglutinin from a h6n1 influenza virus (a/chicken/taiwan/a2837/2013)
PDB Compounds: (D:) ha2

SCOPe Domain Sequences for d4yy0d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4yy0d_ h.3.1.1 (D:) automated matches {Unidentified influenza virus [TaxId: 119212]}
gifgaiagfieggwtgmidgwygyhhensqgsgyaadrestqkaidgitnkvnsiinkmn
tqfeavdhefsnlerrignlnkrmedgfldvwtynaellvllenertldlhdanvknlye
kvksqlrdnandlgngcfefwhkcdnecmesvkngtydy

SCOPe Domain Coordinates for d4yy0d_:

Click to download the PDB-style file with coordinates for d4yy0d_.
(The format of our PDB-style files is described here.)

Timeline for d4yy0d_: