Lineage for d4zkvd_ (4zkv D:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2536878Fold d.13: HIT-like [54196] (2 superfamilies)
    alpha-beta(3)-alpha-beta(2); 3 layers: alpha/beta/alpha
  4. 2536879Superfamily d.13.1: HIT-like [54197] (6 families) (S)
  5. 2536880Family d.13.1.1: HIT (HINT, histidine triad) family of protein kinase-interacting proteins [54198] (8 proteins)
    Pfam PF01230
    topologically similar to the N-terminal domain of protein kinases
  6. 2536979Protein automated matches [191082] (3 species)
    not a true protein
  7. 2536985Species Human (Homo sapiens) [TaxId:9606] [189791] (33 PDB entries)
  8. 2537049Domain d4zkvd_: 4zkv D: [312369]
    automated match to d3tw2a_
    complexed with so4

Details for d4zkvd_

PDB Entry: 4zkv (more details), 1.92 Å

PDB Description: crystal structure of human histidine triad nucleotide-binding protein 1 (hhint1) refined to 1.92a at p21 space group
PDB Compounds: (D:) Histidine triad nucleotide-binding protein 1

SCOPe Domain Sequences for d4zkvd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4zkvd_ d.13.1.1 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rpggdtifgkiirkeipakiifeddrclafhdispqapthflvipkkhisqisvaeddde
sllghlmivgkkcaadlglnkgyrmvvnegsdggqsvyhvhlhvlggrqmhwppg

SCOPe Domain Coordinates for d4zkvd_:

Click to download the PDB-style file with coordinates for d4zkvd_.
(The format of our PDB-style files is described here.)

Timeline for d4zkvd_: