Lineage for d4z9wa_ (4z9w A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2605913Fold d.165: Ribosome inactivating proteins (RIP) [56370] (1 superfamily)
    contains mixed beta-sheet
  4. 2605914Superfamily d.165.1: Ribosome inactivating proteins (RIP) [56371] (3 families) (S)
  5. 2606292Family d.165.1.0: automated matches [191615] (1 protein)
    not a true family
  6. 2606293Protein automated matches [191124] (8 species)
    not a true protein
  7. 2606294Species Bitter gourd (Momordica charantia) [TaxId:3673] [312311] (16 PDB entries)
  8. 2606303Domain d4z9wa_: 4z9w A: [312329]
    Other proteins in same PDB: d4z9wb1, d4z9wb2
    automated match to d1abra_
    complexed with bma, edo, fuc, nag

Details for d4z9wa_

PDB Entry: 4z9w (more details), 1.77 Å

PDB Description: structural studies on a non-toxic homologue of type ii rips from momordica charantia (bitter gourd)-native-2
PDB Compounds: (A:) rRNA N-glycosidase

SCOPe Domain Sequences for d4z9wa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4z9wa_ d.165.1.0 (A:) automated matches {Bitter gourd (Momordica charantia) [TaxId: 3673]}
nlslsqsnfsadtyksfiknlrkqltigasygsagipilkhsvpicerfllvdltngdne
titlainvedagfaayraadrsyffqnappiasyviftdtnqnimnfnntfesieivggt
trsetplgimhfeasifhlfvhdenyvptsflvliqmvleaakfkfieqkvihsimdmed
ftpglamlsleenwtqlslqlqaseslngvfgdsvslynsmdepigvdsmyypiltanma
fqlyqcp

SCOPe Domain Coordinates for d4z9wa_:

Click to download the PDB-style file with coordinates for d4z9wa_.
(The format of our PDB-style files is described here.)

Timeline for d4z9wa_: