SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d1dxqc_ (1dxq C:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2101600Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2102350Superfamily c.23.5: Flavoproteins [52218] (9 families) (S)
  5. 2102504Family c.23.5.3: Quinone reductase [52235] (4 protein domains)
    binds FAD
  6. 2102518Protein NAD(P)H:quinone reductase [52236] (3 species)
  7. 2102552Species Mouse (Mus musculus) [TaxId:10090] [52237] (1 PDB entry)
  8. 2102555Domain d1dxqc_: 1dxq C: [31215]
    complexed with fad

Details for d1dxqc_

PDB Entry: 1dxq (more details), 2.8 Å

PDB Description: crystal structure of mouse nad[p]h-quinone oxidoreductase
PDB Compounds: (C:) quinone reductase

SCOPe Domain Sequences for d1dxqc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dxqc_ c.23.5.3 (C:) NAD(P)H:quinone reductase {Mouse (Mus musculus) [TaxId: 10090]}
aarralivlahsektsfnyamkeaavealkkrgwevlesdlyamnfnpiisrnditgelk
dsknfqypsesslaykegrlspdivaehkkleaadlvifqfplqwfgvpailkgwfervl
vagfaytyaamydngpfqnkktllsittggsgsmyslqgvhgdmnvilwpiqsgilrfcg
fqvlepqlvysightppdarmqilegwkkrletvweetplyfapsslfdlnfqagfllmk
evqeeqkknkfglsvghhlgksipadnqikark

SCOPe Domain Coordinates for d1dxqc_:

Click to download the PDB-style file with coordinates for d1dxqc_.
(The format of our PDB-style files is described here.)

Timeline for d1dxqc_: