PDB entry 1dxq

View 1dxq on RCSB PDB site
Description: crystal structure of mouse nad[p]h-quinone oxidoreductase
Class: flavoprotein
Keywords: flavoprotein, dt-diaphorase, cancer, chemoprotection, chemotherapy, dehydrogenaserossman fold, oxidoreductase
Deposited on 2000-01-14, released 2000-04-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-07-05, with a file datestamp of 2017-06-30.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: N/A
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: quinone reductase
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q64669 (0-272)
      • conflict (237-238)
    Domains in SCOPe 2.07: d1dxqa_
  • Chain 'B':
    Compound: quinone reductase
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q64669 (0-272)
      • conflict (237-238)
    Domains in SCOPe 2.07: d1dxqb_
  • Chain 'C':
    Compound: quinone reductase
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q64669 (0-272)
      • conflict (237-238)
    Domains in SCOPe 2.07: d1dxqc_
  • Chain 'D':
    Compound: quinone reductase
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q64669 (0-272)
      • conflict (237-238)
    Domains in SCOPe 2.07: d1dxqd_
  • Heterogens: FAD

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dxqA (A:)
    aarralivlahsektsfnyamkeaavealkkrgwevlesdlyamnfnpiisrnditgelk
    dsknfqypsesslaykegrlspdivaehkkleaadlvifqfplqwfgvpailkgwfervl
    vagfaytyaamydngpfqnkktllsittggsgsmyslqgvhgdmnvilwpiqsgilrfcg
    fqvlepqlvysightppdarmqilegwkkrletvweetplyfapsslfdlnfqagfllmk
    evqeeqkknkfglsvghhlgksipadnqikark
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dxqB (B:)
    aarralivlahsektsfnyamkeaavealkkrgwevlesdlyamnfnpiisrnditgelk
    dsknfqypsesslaykegrlspdivaehkkleaadlvifqfplqwfgvpailkgwfervl
    vagfaytyaamydngpfqnkktllsittggsgsmyslqgvhgdmnvilwpiqsgilrfcg
    fqvlepqlvysightppdarmqilegwkkrletvweetplyfapsslfdlnfqagfllmk
    evqeeqkknkfglsvghhlgksipadnqikark
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dxqC (C:)
    aarralivlahsektsfnyamkeaavealkkrgwevlesdlyamnfnpiisrnditgelk
    dsknfqypsesslaykegrlspdivaehkkleaadlvifqfplqwfgvpailkgwfervl
    vagfaytyaamydngpfqnkktllsittggsgsmyslqgvhgdmnvilwpiqsgilrfcg
    fqvlepqlvysightppdarmqilegwkkrletvweetplyfapsslfdlnfqagfllmk
    evqeeqkknkfglsvghhlgksipadnqikark
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dxqD (D:)
    aarralivlahsektsfnyamkeaavealkkrgwevlesdlyamnfnpiisrnditgelk
    dsknfqypsesslaykegrlspdivaehkkleaadlvifqfplqwfgvpailkgwfervl
    vagfaytyaamydngpfqnkktllsittggsgsmyslqgvhgdmnvilwpiqsgilrfcg
    fqvlepqlvysightppdarmqilegwkkrletvweetplyfapsslfdlnfqagfllmk
    evqeeqkknkfglsvghhlgksipadnqikark