Lineage for d4ynia_ (4yni A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2423914Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 2423915Superfamily b.82.1: RmlC-like cupins [51182] (25 families) (S)
  5. 2424451Family b.82.1.19: Cysteine dioxygenase type I [141615] (2 proteins)
    Pfam PF05995, CDO_I
  6. 2424452Protein Cysteine dioxygenase type I [141616] (4 species)
  7. 2424472Species Norway rat (Rattus norvegicus) [TaxId:10116] [159291] (55 PDB entries)
  8. 2424525Domain d4ynia_: 4yni A: [312060]
    automated match to d3elna_
    complexed with na, sin

Details for d4ynia_

PDB Entry: 4yni (more details), 2.4 Å

PDB Description: iron free succinate bound rat cysteine dioxygenase
PDB Compounds: (A:) Cysteine dioxygenase type 1

SCOPe Domain Sequences for d4ynia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ynia_ b.82.1.19 (A:) Cysteine dioxygenase type I {Norway rat (Rattus norvegicus) [TaxId: 10116]}
tellkprtladlirilhelfagdevnveevqavleayesnpaewalyakfdqyrytrnlv
dqgngkfnlmilcwgeghgssihdhtdshcflkllqgnlketlfdwpdkksnemikkser
tlrenqcayindsiglhrvenvshtepavslhlysppfdtchafdqrtghknkvtmtfhs
kfgirtp

SCOPe Domain Coordinates for d4ynia_:

Click to download the PDB-style file with coordinates for d4ynia_.
(The format of our PDB-style files is described here.)

Timeline for d4ynia_: