Lineage for d4ygbc_ (4ygb C:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2373039Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2373040Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 2374854Family b.29.1.13: Lectin leg-like [74904] (4 protein domains)
    mammalian protein related to legume lectins
    automatically mapped to Pfam PF03388
  6. 2374876Protein automated matches [190462] (2 species)
    not a true protein
  7. 2374882Species Human (Homo sapiens) [TaxId:9606] [197238] (11 PDB entries)
  8. 2374886Domain d4ygbc_: 4ygb C: [311979]
    automated match to d4gkya_
    complexed with ca, gol

Details for d4ygbc_

PDB Entry: 4ygb (more details), 1.6 Å

PDB Description: crystal structure of ergic-53/mcfd2, monoclinic calcium-free form
PDB Compounds: (C:) Protein ERGIC-53

SCOPe Domain Sequences for d4ygbc_:

Sequence, based on SEQRES records: (download)

>d4ygbc_ b.29.1.13 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
phrrfeykysfkgphlvqsdgtvpfwahagnaipssdqirvapslksqrgsvwtktkaaf
enwevevtfrvtgrgrigadglaiwyaenqglegpvfgsadlwngvgiffdsfdndgkkn
npaiviignngqihydhqndgasqalascqrdfrnkpypvrakityyqntltvminngft
pdkndyefcakvenmiipaqghfgisaatggladdhdvlsfltfqlt

Sequence, based on observed residues (ATOM records): (download)

>d4ygbc_ b.29.1.13 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
phrrfeykysfkgphlvqsdgtvpfwahagnaipssdqirvapslksqrgsvwtktkaaf
enwevevtfrvtgrgrigadglaiwyaewngvgiffdsfnpaiviignqalascqrdfrn
kpypvrakityyqntltvminngftpdkndyefcakvenmiipaqghfgisaatggladd
hdvlsfltfqlt

SCOPe Domain Coordinates for d4ygbc_:

Click to download the PDB-style file with coordinates for d4ygbc_.
(The format of our PDB-style files is described here.)

Timeline for d4ygbc_: