PDB entry 4ygb

View 4ygb on RCSB PDB site
Description: Crystal structure of ERGIC-53/MCFD2, monoclinic calcium-free form
Class: protein transport
Keywords: beta-sandwich, ef-hand, cargo receptor, calcium binding, er, ergic, protein transport
Deposited on 2015-02-26, released 2016-04-06
The last revision prior to the SCOPe 2.06 freeze date was dated 2016-04-06, with a file datestamp of 2016-04-01.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: N/A
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein ERGIC-53
    Species: Homo sapiens [TaxId:9606]
    Gene: LMAN1, ERGIC53, F5F8D
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4ygba_
  • Chain 'B':
    Compound: multiple coagulation factor deficiency protein 2
    Species: Homo sapiens [TaxId:9606]
    Gene: MCFD2, SDNSF
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: Protein ERGIC-53
    Species: Homo sapiens [TaxId:9606]
    Gene: LMAN1, ERGIC53, F5F8D
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4ygbc_
  • Chain 'D':
    Compound: multiple coagulation factor deficiency protein 2
    Species: Homo sapiens [TaxId:9606]
    Gene: MCFD2, SDNSF
    Database cross-references and differences (RAF-indexed):
  • Heterogens: GOL, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4ygbA (A:)
    mnhkvhmdgvggdpavalphrrfeykysfkgphlvqsdgtvpfwahagnaipssdqirva
    pslksqrgsvwtktkaafenwevevtfrvtgrgrigadglaiwyaenqglegpvfgsadl
    wngvgiffdsfdndgkknnpaiviignngqihydhqndgasqalascqrdfrnkpypvra
    kityyqntltvminngftpdkndyefcakvenmiipaqghfgisaatggladdhdvlsfl
    tfqlte
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ygbA (A:)
    phrrfeykysfkgphlvqsdgtvpfwahagnaipssdqirvapslksqrgsvwtktkaaf
    enwevevtfrvtgrgrigadglaiwyaewngvgiffdsfnpaiviignqalascqrdfrn
    kpypvrakityyqntltvminngftpdkndyefcakvenmiipaqghfgisaatggladd
    hdvlsfltfqlt
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4ygbC (C:)
    mnhkvhmdgvggdpavalphrrfeykysfkgphlvqsdgtvpfwahagnaipssdqirva
    pslksqrgsvwtktkaafenwevevtfrvtgrgrigadglaiwyaenqglegpvfgsadl
    wngvgiffdsfdndgkknnpaiviignngqihydhqndgasqalascqrdfrnkpypvra
    kityyqntltvminngftpdkndyefcakvenmiipaqghfgisaatggladdhdvlsfl
    tfqlte
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ygbC (C:)
    phrrfeykysfkgphlvqsdgtvpfwahagnaipssdqirvapslksqrgsvwtktkaaf
    enwevevtfrvtgrgrigadglaiwyaewngvgiffdsfnpaiviignqalascqrdfrn
    kpypvrakityyqntltvminngftpdkndyefcakvenmiipaqghfgisaatggladd
    hdvlsfltfqlt
    

  • Chain 'D':
    No sequence available.