Lineage for d1ofva_ (1ofv A:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1356042Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 1356722Superfamily c.23.5: Flavoproteins [52218] (9 families) (S)
  5. 1356723Family c.23.5.1: Flavodoxin-related [52219] (6 proteins)
    binds FMN
  6. 1356724Protein Flavodoxin [52220] (9 species)
  7. 1356797Species Synechococcus elongatus PCC 7942 [TaxId:1140] [52225] (10 PDB entries)
  8. 1356802Domain d1ofva_: 1ofv A: [31184]
    complexed with fmn

Details for d1ofva_

PDB Entry: 1ofv (more details), 1.7 Å

PDB Description: flavodoxin from anacystis nidulans: refinement of two forms of the oxidized protein
PDB Compounds: (A:) flavodoxin

SCOPe Domain Sequences for d1ofva_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ofva_ c.23.5.1 (A:) Flavodoxin {Synechococcus elongatus PCC 7942 [TaxId: 1140]}
akiglfygtqtgvtqtiaesiqqefggesivdlndianadasdlnaydyliigcptwnvg
elqsdwegiyddldsvnfqgkkvayfgagdqvgysdnfqdamgileekisslgsqtvgyw
piegydfneskavrnnqfvglaidednqpdltknriktwvsqlksefgl

SCOPe Domain Coordinates for d1ofva_:

Click to download the PDB-style file with coordinates for d1ofva_.
(The format of our PDB-style files is described here.)

Timeline for d1ofva_: