Lineage for d1ofv__ (1ofv -)
- Root: SCOP 1.55
Class c: Alpha and beta proteins (a/b) [51349] (97 folds) 
Fold c.23: Flavodoxin-like [52171] (16 superfamilies) 
Superfamily c.23.5: Flavoproteins [52218] (3 families) 
Family c.23.5.1: Flavodoxin-related [52219] (3 proteins) Protein Flavodoxin [52220] (6 species) 
Species Anacystis nidulans and Synechococcus, pcc 7942 [52225] (10 PDB entries) 
Domain d1ofv__: 1ofv - [31184]
Details for d1ofv__
PDB Entry: 1ofv (more details), 1.7 Å
PDB Description: flavodoxin from anacystis nidulans: refinement of two forms of the oxidized protein
SCOP Domain Sequences for d1ofv__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ofv__ c.23.5.1 (-) Flavodoxin {Anacystis nidulans and Synechococcus, pcc 7942}
akiglfygtqtgvtqtiaesiqqefggesivdlndianadasdlnaydyliigcptwnvg
elqsdwegiyddldsvnfqgkkvayfgagdqvgysdnfqdamgileekisslgsqtvgyw
piegydfneskavrnnqfvglaidednqpdltknriktwvsqlksefgl
SCOP Domain Coordinates for d1ofv__:
Click to download the PDB-style file with coordinates for d1ofv__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ofv__:
- d1ofv__ appears in SCOP 1.57
- d1ofv__ appears in the current release, SCOPe 2.08, called d1ofva_
View in 3D