Lineage for d1ag9b_ (1ag9 B:)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 68133Fold c.23: Flavodoxin-like [52171] (17 superfamilies)
  4. 68298Superfamily c.23.5: Flavoproteins [52218] (3 families) (S)
  5. 68299Family c.23.5.1: Flavodoxin-related [52219] (3 proteins)
  6. 68300Protein Flavodoxin [52220] (6 species)
  7. 68364Species Escherichia coli [TaxId:562] [52224] (2 PDB entries)
  8. 68366Domain d1ag9b_: 1ag9 B: [31179]

Details for d1ag9b_

PDB Entry: 1ag9 (more details), 1.8 Å

PDB Description: flavodoxins that are required for enzyme activation: the structure of oxidized flavodoxin from escherichia coli at 1.8 angstroms resolution.

SCOP Domain Sequences for d1ag9b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ag9b_ c.23.5.1 (B:) Flavodoxin {Escherichia coli}
aitgiffgsdtgnteniakmiqkqlgkdvadvhdiaksskedleaydilllgiptwyyge
aqcdwddffptleeidfngklvalfgcgdqedyaeyfcdalgtirdiieprgativghwp
tagyhfeaskgladddhfvglaidedrqpeltaervekwvkqiseelhldeilna

SCOP Domain Coordinates for d1ag9b_:

Click to download the PDB-style file with coordinates for d1ag9b_.
(The format of our PDB-style files is described here.)

Timeline for d1ag9b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1ag9a_