Lineage for d1ag9b_ (1ag9 B:)
- Root: SCOP 1.55
Class c: Alpha and beta proteins (a/b) [51349] (97 folds) 
Fold c.23: Flavodoxin-like [52171] (16 superfamilies) 
Superfamily c.23.5: Flavoproteins [52218] (3 families) 
Family c.23.5.1: Flavodoxin-related [52219] (3 proteins) Protein Flavodoxin [52220] (6 species) 
Species Escherichia coli [TaxId:562] [52224] (2 PDB entries) 
Domain d1ag9b_: 1ag9 B: [31179]
Details for d1ag9b_
PDB Entry: 1ag9 (more details), 1.8 Å
PDB Description: flavodoxins that are required for enzyme activation: the structure of oxidized flavodoxin from escherichia coli at 1.8 angstroms resolution.
SCOP Domain Sequences for d1ag9b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ag9b_ c.23.5.1 (B:) Flavodoxin {Escherichia coli}
aitgiffgsdtgnteniakmiqkqlgkdvadvhdiaksskedleaydilllgiptwyyge
aqcdwddffptleeidfngklvalfgcgdqedyaeyfcdalgtirdiieprgativghwp
tagyhfeaskgladddhfvglaidedrqpeltaervekwvkqiseelhldeilna
SCOP Domain Coordinates for d1ag9b_:
Click to download the PDB-style file with coordinates for d1ag9b_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ag9b_:
- d1ag9b_ appears in SCOP 1.57
- d1ag9b_ appears in the current release, SCOPe 2.08
View in 3D
