SCOPe 2.04: Domain d1ag9a_: 1ag9 A:

Lineage for d1ag9a_ (1ag9 A:)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.5: Flavoproteins [52218] (9 families)

5. Family c.23.5.1: Flavodoxin-related [52219] (6 proteins)
   binds FMN

6. Protein Flavodoxin [52220] (9 species)

7. Species Escherichia coli [TaxId:562] [52224] (2 PDB entries)

8. Domain d1ag9a_: 1ag9 A: [31178]
   complexed with btb, ca, cl, fmn, na

Details for d1ag9a_

PDB Entry: 1ag9, 1.8 Å

PDB Description: flavodoxins that are required for enzyme activation: the structure of oxidized flavodoxin from escherichia coli at 1.8 angstroms resolution.

PDB Compounds: (A:) flavodoxin

SCOPe Domain Sequences for d1ag9a_:

Sequence; same for both SEQRES and ATOM records:

>d1ag9a_ c.23.5.1 (A:) Flavodoxin {Escherichia coli [TaxId: 562]}
aitgiffgsdtgnteniakmiqkqlgkdvadvhdiaksskedleaydilllgiptwyyge
aqcdwddffptleeidfngklvalfgcgdqedyaeyfcdalgtirdiieprgativghwp
tagyhfeaskgladddhfvglaidedrqpeltaervekwvkqiseelhldeilna

Timeline for d1ag9a_:

• d1ag9a_ first appeared (with stable ids) in SCOP 1.55
  
• d1ag9a_ appears in SCOPe 2.03
  
• d1ag9a_ appears in SCOPe 2.05
  
• d1ag9a_ appears in the current release, SCOPe 2.08