Lineage for d4xzba1 (4xzb A:2-306)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2434695Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2438500Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2439241Family c.1.8.3: beta-glycanases [51487] (27 proteins)
    consist of a number of sequence families
  6. 2439898Protein automated matches [190057] (27 species)
    not a true protein
  7. 2439981Species Geobacillus sp. [TaxId:575526] [311753] (1 PDB entry)
  8. 2439982Domain d4xzba1: 4xzb A:2-306 [311754]
    Other proteins in same PDB: d4xzba2
    automated match to d1qi2a_

Details for d4xzba1

PDB Entry: 4xzb (more details), 1.62 Å

PDB Description: endo-glucanase gscela p1
PDB Compounds: (A:) CelA

SCOPe Domain Sequences for d4xzba1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4xzba1 c.1.8.3 (A:2-306) automated matches {Geobacillus sp. [TaxId: 575526]}
ertpveengrlqvvgtallnqhnkpfqlrgisthglqwfgqfankdafqtlrddwkanvv
rlamytdpnangyiaqpewlkakvkegvqaaldlgmyviidwhilndndpnlykeqakrf
faemareygkypnviyeianepngndvtweekirpyadevirtirsidrdnliivgtgtw
sqdvddvasdplpyknimyavhfysgthtqwlrdrvdaalqagtpvfvsewgtsdasgdg
gpyleeaekwieflnergiswvnwslcdkneasaalrpgadphggwgddhlsdsgrfika
kliea

SCOPe Domain Coordinates for d4xzba1:

Click to download the PDB-style file with coordinates for d4xzba1.
(The format of our PDB-style files is described here.)

Timeline for d4xzba1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4xzba2