Lineage for d4piza_ (4piz A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2814470Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 2814471Superfamily b.82.1: RmlC-like cupins [51182] (25 families) (S)
  5. 2815005Family b.82.1.19: Cysteine dioxygenase type I [141615] (2 proteins)
    Pfam PF05995, CDO_I
  6. 2815006Protein Cysteine dioxygenase type I [141616] (4 species)
  7. 2815026Species Norway rat (Rattus norvegicus) [TaxId:10116] [159291] (55 PDB entries)
  8. 2815051Domain d4piza_: 4piz A: [311692]
    automated match to d3elna_
    complexed with fe, hcs

Details for d4piza_

PDB Entry: 4piz (more details), 1.4 Å

PDB Description: homocysteine-bound cysteine dioxygenase at ph 6.2
PDB Compounds: (A:) Cysteine dioxygenase type 1

SCOPe Domain Sequences for d4piza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4piza_ b.82.1.19 (A:) Cysteine dioxygenase type I {Norway rat (Rattus norvegicus) [TaxId: 10116]}
ellkprtladlirilhelfagdevnveevqavleayesnpaewalyakfdqyrytrnlvd
qgngkfnlmilcwgeghgssihdhtdshcflkllqgnlketlfdwpdkksnemikksert
lrenqcayindsiglhrvenvshtepavslhlysppfdtchafdqrtghknkvtmtfhsk
fgirtp

SCOPe Domain Coordinates for d4piza_:

Click to download the PDB-style file with coordinates for d4piza_.
(The format of our PDB-style files is described here.)

Timeline for d4piza_: