SCOPe 2.07: Domain d3x26a_: 3x26 A:

Lineage for d3x26a_ (3x26 A:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.149: Nitrile hydratase alpha chain [56208] (1 superfamily)
   4 layers a/b/b/a; inside is a sandwich of two 2-stranded beta-sheets

4. Superfamily d.149.1: Nitrile hydratase alpha chain [56209] (2 families)
   duplication: contains two structural repeats

5. Family d.149.1.1: Nitrile hydratase alpha chain [56210] (3 proteins)
   automatically mapped to Pfam PF02979

6. Protein automated matches [190256] (6 species)
   not a true protein

7. Species Rhodococcus erythropolis [TaxId:1833] [187042] (24 PDB entries)

8. Domain d3x26a_: 3x26 A: [311688]
   Other proteins in same PDB: d3x26b_
   automated match to d2ahja_
   complexed with cl, fe, mg, tan; mutant

Details for d3x26a_

PDB Entry: 3x26, 1.34 Å

PDB Description: crystal structure of nitrile hydratase mutant br56k complexed with trimethylacetonitrile, photo-activated for 5 min

PDB Compounds: (A:) Nitrile hydratase subunit alpha

SCOPe Domain Sequences for d3x26a_:

Sequence; same for both SEQRES and ATOM records:

>d3x26a_ d.149.1.1 (A:) automated matches {Rhodococcus erythropolis [TaxId: 1833]}
enaapaqapvsdrawalfraldgkglvpdgyvegwkktfeedfsprrgaelvarawtdpe
frqllltdgtaavaqygylgpqgeyivavedtptlknvivcslcsctawpilglpptwyk
sfeyrarvvreprkvlsemgteiasdieirvydttaetrymvlpqrpagtegwsqeqlqe
ivtkdcligvaipqvpt

Timeline for d3x26a_:

• d3x26a_ first appeared in SCOPe 2.06
  
• d3x26a_ appears in the current release, SCOPe 2.08