Lineage for d5fx2__ (5fx2 -)
- Root: SCOP 1.61
Class c: Alpha and beta proteins (a/b) [51349] (117 folds) 
Fold c.23: Flavodoxin-like [52171] (16 superfamilies) 
Superfamily c.23.5: Flavoproteins [52218] (3 families) 
Family c.23.5.1: Flavodoxin-related [52219] (3 proteins) Protein Flavodoxin [52220] (7 species) Species Desulfovibrio vulgaris [TaxId:881] [52222] (20 PDB entries) 
Domain d5fx2__: 5fx2 - [31166]
Details for d5fx2__
PDB Entry: 5fx2 (more details), 1.9 Å
PDB Description: comparison of the crystal structures of a flavodoxin in its three oxidation states at cryogenic temperatures
SCOP Domain Sequences for d5fx2__:
Sequence; same for both SEQRES and ATOM records: (download)
>d5fx2__ c.23.5.1 (-) Flavodoxin {Desulfovibrio vulgaris}
akalivygsttgnteytaetiareladagyevdsrdaasveagglfegfdlvllgcstwg
ddsielqddfiplfdsleetgaqgrkvacfgcgdssyeyfcgavdaieeklknlgaeivq
dglridgdpraarddivgwahdvrgai
SCOP Domain Coordinates for d5fx2__:
Click to download the PDB-style file with coordinates for d5fx2__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d5fx2__:
- d5fx2__ first appeared (with stable ids) in SCOP 1.55
- d5fx2__ appears in SCOP 1.59
- d5fx2__ appears in SCOP 1.63
- d5fx2__ appears in the current release, SCOPe 2.08, called d5fx2a_
View in 3D