| Class b: All beta proteins [48724] (178 folds) |
| Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies) one turn of helix is made by two pairs of antiparallel strands linked with short turns has appearance of a sandwich of distinct architecture and jelly-roll topology |
Superfamily b.82.1: RmlC-like cupins [51182] (25 families) ![]() |
| Family b.82.1.19: Cysteine dioxygenase type I [141615] (2 proteins) Pfam PF05995, CDO_I |
| Protein Cysteine dioxygenase type I [141616] (4 species) |
| Species Norway rat (Rattus norvegicus) [TaxId:10116] [159291] (55 PDB entries) |
| Domain d4piya_: 4piy A: [311644] automated match to d4ubga_ complexed with fe, hcs |
PDB Entry: 4piy (more details), 1.6 Å
SCOPe Domain Sequences for d4piya_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4piya_ b.82.1.19 (A:) Cysteine dioxygenase type I {Norway rat (Rattus norvegicus) [TaxId: 10116]}
ellkprtladlirilhelfagdevnveevqavleayesnpaewalyakfdqyrytrnlvd
qgngkfnlmilcwgeghgssihdhtdshaflkllqgnlketlfdwpdkksnemikksert
lrenqcayindsiglhrvenvshtepavslhlysppfdtchafdqrtghknkvtmtfhsk
fgirtp
Timeline for d4piya_: