Lineage for d4xfha_ (4xfh A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2423914Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 2423915Superfamily b.82.1: RmlC-like cupins [51182] (25 families) (S)
  5. 2424451Family b.82.1.19: Cysteine dioxygenase type I [141615] (2 proteins)
    Pfam PF05995, CDO_I
  6. 2424452Protein Cysteine dioxygenase type I [141616] (4 species)
  7. 2424472Species Norway rat (Rattus norvegicus) [TaxId:10116] [159291] (55 PDB entries)
  8. 2424495Domain d4xfha_: 4xfh A: [311634]
    automated match to d4ubha_
    complexed with cys, fe

Details for d4xfha_

PDB Entry: 4xfh (more details), 1.35 Å

PDB Description: cysteine dioxygenase variant - y157f at ph 6.2 with cysteine
PDB Compounds: (A:) Cysteine dioxygenase type 1

SCOPe Domain Sequences for d4xfha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4xfha_ b.82.1.19 (A:) Cysteine dioxygenase type I {Norway rat (Rattus norvegicus) [TaxId: 10116]}
ellkprtladlirilhelfagdevnveevqavleayesnpaewalyakfdqyrytrnlvd
qgngkfnlmilcwgeghgssihdhtdshcflkllqgnlketlfdwpdkksnemikksert
lrenqcayindsiglhrvenvshtepavslhlfsppfdtchafdqrtghknkvtmtfhsk
fgirtp

SCOPe Domain Coordinates for d4xfha_:

Click to download the PDB-style file with coordinates for d4xfha_.
(The format of our PDB-style files is described here.)

Timeline for d4xfha_: