Class b: All beta proteins [48724] (177 folds) |
Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) |
Family b.29.1.0: automated matches [191363] (1 protein) not a true family |
Protein automated matches [190437] (53 species) not a true protein |
Species Vatairea macrocarpa [TaxId:77050] [268912] (6 PDB entries) |
Domain d4wv8b_: 4wv8 B: [311614] automated match to d4u36a_ complexed with ca, lbt, mn |
PDB Entry: 4wv8 (more details), 1.83 Å
SCOPe Domain Sequences for d4wv8b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4wv8b_ b.29.1.0 (B:) automated matches {Vatairea macrocarpa [TaxId: 77050]} msevvsfsftkfnpnpkdiilqgdalvtskgklqltkvkdgkpvdhslgralyaapihiw ddstdrvasfatsfsfvveapdesktadgiafflappdtqpqkdggflglfndsnksiqt vavefdtfsntwdpsarhiginvnsiesmkyvkwgwengkvanvyisyeastktltaslt ypsnatsyivsanvdlksalpewvrvgfsatsglsrdhvethdvldwsftstlqaps
Timeline for d4wv8b_: