Lineage for d4wv8b_ (4wv8 B:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2049732Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2049733Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 2051795Family b.29.1.0: automated matches [191363] (1 protein)
    not a true family
  6. 2051796Protein automated matches [190437] (53 species)
    not a true protein
  7. 2052398Species Vatairea macrocarpa [TaxId:77050] [268912] (6 PDB entries)
  8. 2052402Domain d4wv8b_: 4wv8 B: [311614]
    automated match to d4u36a_
    complexed with ca, lbt, mn

Details for d4wv8b_

PDB Entry: 4wv8 (more details), 1.83 Å

PDB Description: crystal structure of a recombinant vatairea macrocarpa seed lectin complexed with lactose
PDB Compounds: (B:) seed lectin

SCOPe Domain Sequences for d4wv8b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4wv8b_ b.29.1.0 (B:) automated matches {Vatairea macrocarpa [TaxId: 77050]}
msevvsfsftkfnpnpkdiilqgdalvtskgklqltkvkdgkpvdhslgralyaapihiw
ddstdrvasfatsfsfvveapdesktadgiafflappdtqpqkdggflglfndsnksiqt
vavefdtfsntwdpsarhiginvnsiesmkyvkwgwengkvanvyisyeastktltaslt
ypsnatsyivsanvdlksalpewvrvgfsatsglsrdhvethdvldwsftstlqaps

SCOPe Domain Coordinates for d4wv8b_:

Click to download the PDB-style file with coordinates for d4wv8b_.
(The format of our PDB-style files is described here.)

Timeline for d4wv8b_: