Lineage for d4xfga_ (4xfg A:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2080271Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 2080272Superfamily b.82.1: RmlC-like cupins [51182] (25 families) (S)
  5. 2080777Family b.82.1.19: Cysteine dioxygenase type I [141615] (2 proteins)
    Pfam PF05995, CDO_I
  6. 2080778Protein Cysteine dioxygenase type I [141616] (4 species)
  7. 2080786Species Norway rat (Rattus norvegicus) [TaxId:10116] [159291] (51 PDB entries)
  8. 2080815Domain d4xfga_: 4xfg A: [311595]
    automated match to d4ubga_
    complexed with cl, cys, fe

Details for d4xfga_

PDB Entry: 4xfg (more details), 1.4 Å

PDB Description: cysteine dioxygenase variant - c93a at ph 6.2 with cysteine
PDB Compounds: (A:) Cysteine dioxygenase type 1

SCOPe Domain Sequences for d4xfga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4xfga_ b.82.1.19 (A:) Cysteine dioxygenase type I {Norway rat (Rattus norvegicus) [TaxId: 10116]}
ellkprtladlirilhelfagdevnveevqavleayesnpaewalyakfdqyrytrnlvd
qgngkfnlmilcwgeghgssihdhtdshaflkllqgnlketlfdwpdkksnemikksert
lrenqcayindsiglhrvenvshtepavslhlysppfdtchafdqrtghknkvtmtfhsk
fgirtp

SCOPe Domain Coordinates for d4xfga_:

Click to download the PDB-style file with coordinates for d4xfga_.
(The format of our PDB-style files is described here.)

Timeline for d4xfga_: