Lineage for d1cqie1 (1cqi E:239-385)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 982187Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 982597Superfamily c.23.4: Succinyl-CoA synthetase domains [52210] (1 family) (S)
  5. 982598Family c.23.4.1: Succinyl-CoA synthetase domains [52211] (3 proteins)
    contain additional N-terminal strand "0", antiparallel to strand 2
  6. 982640Protein Succinyl-CoA synthetase, beta-chain, C-terminal domain [52215] (2 species)
  7. 982641Species Escherichia coli [TaxId:562] [52216] (11 PDB entries)
  8. 982665Domain d1cqie1: 1cqi E:239-385 [31148]
    Other proteins in same PDB: d1cqia1, d1cqia2, d1cqib2, d1cqid1, d1cqid2, d1cqie2
    complexed with adp, coa, mg, po4

Details for d1cqie1

PDB Entry: 1cqi (more details), 3.3 Å

PDB Description: crystal structure of the complex of adp and mg2+ with dephosphorylated e. coli succinyl-coa synthetase
PDB Compounds: (E:) protein (succinyl-coa synthetase beta chain)

SCOPe Domain Sequences for d1cqie1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cqie1 c.23.4.1 (E:239-385) Succinyl-CoA synthetase, beta-chain, C-terminal domain {Escherichia coli [TaxId: 562]}
dpreaqaaqwelnyvaldgnigcmvngaglamgtmdivklhggepanfldvgggatkerv
teafkiilsddkvkavlvnifggivrcdliadgiigavaevgvnvpvvvrlegnnaelga
kkladsglniiaakgltdaaqqvvaav

SCOPe Domain Coordinates for d1cqie1:

Click to download the PDB-style file with coordinates for d1cqie1.
(The format of our PDB-style files is described here.)

Timeline for d1cqie1: