SCOPe 2.05: Domain d1cqib1: 1cqi B:239-385

Lineage for d1cqib1 (1cqi B:239-385)

Root: SCOPe 2.05
Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
Superfamily c.23.4: Succinyl-CoA synthetase domains [52210] (2 families)
Family c.23.4.1: Succinyl-CoA synthetase domains [52211] (3 proteins)
contain additional N-terminal strand "0", antiparallel to strand 2
Protein Succinyl-CoA synthetase, beta-chain, C-terminal domain [52215] (2 species)
Species Escherichia coli [TaxId:562] [52216] (11 PDB entries)
Domain d1cqib1: 1cqi B:239-385 [31147]
Other proteins in same PDB: d1cqia1, d1cqia2, d1cqib2, d1cqid1, d1cqid2, d1cqie2
complexed with adp, coa, mg, po4

Details for d1cqib1

PDB Entry: 1cqi (more details), 3.3 Å

PDB Description: crystal structure of the complex of adp and mg2+ with dephosphorylated e. coli succinyl-coa synthetase

PDB Compounds: (B:) protein (succinyl-coa synthetase beta chain)

SCOPe Domain Sequences for d1cqib1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cqib1 c.23.4.1 (B:239-385) Succinyl-CoA synthetase, beta-chain, C-terminal domain {Escherichia coli [TaxId: 562]}
dpreaqaaqwelnyvaldgnigcmvngaglamgtmdivklhggepanfldvgggatkerv
teafkiilsddkvkavlvnifggivrcdliadgiigavaevgvnvpvvvrlegnnaelga
kkladsglniiaakgltdaaqqvvaav

SCOPe Domain Coordinates for d1cqib1:

Click to download the PDB-style file with coordinates for d1cqib1.
(The format of our PDB-style files is described here.)

Timeline for d1cqib1: