Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.1: CheY-like [52172] (8 families) |
Family c.23.1.1: CheY-related [52173] (26 proteins) |
Protein Sporulation response regulator Spo0F [52188] (1 species) |
Species Bacillus subtilis [TaxId:1423] [52189] (12 PDB entries) Uniprot P06628 |
Domain d1f51h_: 1f51 H: [31117] Other proteins in same PDB: d1f51a_, d1f51b_, d1f51c_, d1f51d_ complexed with mg |
PDB Entry: 1f51 (more details), 3 Å
SCOPe Domain Sequences for d1f51h_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1f51h_ c.23.1.1 (H:) Sporulation response regulator Spo0F {Bacillus subtilis [TaxId: 1423]} nekilivddqsgirillnevfnkegyqtfqaanglqaldivtkerpdlvlldmkipgmdg ieilkrmkvidenirviimtaygeldmiqeskelgalthfakpfdideirdavkkylpl
Timeline for d1f51h_: