Lineage for d1f51h_ (1f51 H:)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 21773Fold c.23: Flavodoxin-like [52171] (16 superfamilies)
  4. 21774Superfamily c.23.1: CheY-like [52172] (3 families) (S)
  5. 21775Family c.23.1.1: CheY-related [52173] (9 proteins)
  6. 21856Protein Sporulation response regulator Spo0F [52188] (1 species)
  7. 21857Species Bacillus subtilis [TaxId:1423] [52189] (5 PDB entries)
  8. 21865Domain d1f51h_: 1f51 H: [31117]
    Other proteins in same PDB: d1f51a_, d1f51b_, d1f51c_, d1f51d_

Details for d1f51h_

PDB Entry: 1f51 (more details), 3 Å

PDB Description: a transient interaction between two phosphorelay proteins trapped in a crystal lattice reveals the mechanism of molecular recognition and phosphotransfer in singal transduction

SCOP Domain Sequences for d1f51h_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f51h_ c.23.1.1 (H:) Sporulation response regulator Spo0F {Bacillus subtilis}
nekilivddqsgirillnevfnkegyqtfqaanglqaldivtkerpdlvlldmkipgmdg
ieilkrmkvidenirviimtaygeldmiqeskelgalthfakpfdideirdavkkylpl

SCOP Domain Coordinates for d1f51h_:

Click to download the PDB-style file with coordinates for d1f51h_.
(The format of our PDB-style files is described here.)

Timeline for d1f51h_: