Lineage for d1dc8a_ (1dc8 A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2463694Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2463695Superfamily c.23.1: CheY-like [52172] (8 families) (S)
  5. 2463696Family c.23.1.1: CheY-related [52173] (26 proteins)
  6. 2463841Protein NTRC receiver domain [52180] (1 species)
  7. 2463842Species Salmonella typhimurium [TaxId:90371] [52181] (8 PDB entries)
  8. 2463849Domain d1dc8a_: 1dc8 A: [31094]

Details for d1dc8a_

PDB Entry: 1dc8 (more details)

PDB Description: structure of a transiently phosphorylated "switch" in bacterial signal transduction
PDB Compounds: (A:) nitrogen regulation protein

SCOPe Domain Sequences for d1dc8a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dc8a_ c.23.1.1 (A:) NTRC receiver domain {Salmonella typhimurium [TaxId: 90371]}
mqrgivwvvdddssirwvleralagagltcttfengnevlaalasktpdvllsdirmpgm
dglallkqikqrhpmlpviimtahsdldaavsayqqgafdylpkpfdideavalverais
hyqe

SCOPe Domain Coordinates for d1dc8a_:

Click to download the PDB-style file with coordinates for d1dc8a_.
(The format of our PDB-style files is described here.)

Timeline for d1dc8a_: