SCOP 1.61: Domain d4tmyb_: 4tmy B:

Lineage for d4tmyb_ (4tmy B:)

1. Root: SCOP 1.61

2. Class c: Alpha and beta proteins (a/b) [51349] (117 folds)

3. Fold c.23: Flavodoxin-like [52171] (16 superfamilies)

4. Superfamily c.23.1: CheY-like [52172] (4 families)

5. Family c.23.1.1: CheY-related [52173] (10 proteins)

6. Protein CheY protein [52174] (3 species)

7. Species Thermotoga maritima [TaxId:243274] [52177] (4 PDB entries)

8. Domain d4tmyb_: 4tmy B: [31088]

Details for d4tmyb_

PDB Entry: 4tmy, 2.8 Å

PDB Description: chey from thermotoga maritima (mg-iv)

SCOP Domain Sequences for d4tmyb_:

Sequence; same for both SEQRES and ATOM records:

>d4tmyb_ c.23.1.1 (B:) CheY protein {Thermotoga maritima}
gkrvlivddaafmrmmlkdiitkagyevageatngreavekykelkpdivtmditmpemn
gidaikeimkidpnakiivcsamgqqamvieaikagakdfivkpfqpsrvvealnkvs

Timeline for d4tmyb_:

• d4tmyb_ first appeared (with stable ids) in SCOP 1.55
  
• d4tmyb_ appears in SCOP 1.59
  
• d4tmyb_ appears in SCOP 1.63
  
• d4tmyb_ appears in the current release, SCOPe 2.08