Class c: Alpha and beta proteins (a/b) [51349] (117 folds) |
Fold c.23: Flavodoxin-like [52171] (16 superfamilies) |
Superfamily c.23.1: CheY-like [52172] (4 families) |
Family c.23.1.1: CheY-related [52173] (10 proteins) |
Protein CheY protein [52174] (3 species) |
Species Thermotoga maritima [TaxId:243274] [52177] (4 PDB entries) |
Domain d4tmyb_: 4tmy B: [31088] |
PDB Entry: 4tmy (more details), 2.8 Å
SCOP Domain Sequences for d4tmyb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4tmyb_ c.23.1.1 (B:) CheY protein {Thermotoga maritima} gkrvlivddaafmrmmlkdiitkagyevageatngreavekykelkpdivtmditmpemn gidaikeimkidpnakiivcsamgqqamvieaikagakdfivkpfqpsrvvealnkvs
Timeline for d4tmyb_: