| Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
| Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.1: CheY-like [52172] (7 families) ![]() |
| Family c.23.1.1: CheY-related [52173] (25 proteins) |
| Protein CheY protein [52174] (4 species) |
| Species Salmonella typhimurium [TaxId:90371] [52176] (11 PDB entries) |
| Domain d2chya_: 2chy A: [31081] CA-atoms only, mutant protein sequence |
PDB Entry: 2chy (more details), 2.7 Å
SCOP Domain Sequences for d2chya_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2chya_ c.23.1.1 (A:) CheY protein {Salmonella typhimurium [TaxId: 602]}
adkelkflvvddfstmrrivrnllkelgfnnveeaedgvdalnklqaggfgfiicdwnmp
nmdglellktiradsamsalpvlmvtaeakkeniiaaaqagasgyvvkpftaatleekln
kifeklgm
Timeline for d2chya_: