SCOPe 2.08: Domain d2chya_: 2chy A:

Lineage for d2chya_ (2chy A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.1: CheY-like [52172] (8 families)

5. Family c.23.1.1: CheY-related [52173] (26 proteins)

6. Protein CheY protein [52174] (6 species)

7. Species Salmonella typhimurium [TaxId:90371] [52176] (13 PDB entries)

8. Domain d2chya_: 2chy A: [31081]
   CA-atoms only, mutant protein sequence

Details for d2chya_

PDB Entry: 2chy, 2.7 Å

PDB Description: three-dimensional structure of chey, the response regulator of bacterial chemotaxis

PDB Compounds: (A:) chey

SCOPe Domain Sequences for d2chya_:

Sequence; same for both SEQRES and ATOM records:

>d2chya_ c.23.1.1 (A:) CheY protein {Salmonella typhimurium [TaxId: 90371]}
adkelkflvvddfstmrrivrnllkelgfnnveeaedgvdalnklqaggfgfiicdwnmp
nmdglellktiradsamsalpvlmvtaeakkeniiaaaqagasgyvvkpftaatleekln
kifeklgm

Timeline for d2chya_:

• d2chya_ first appeared (with stable ids) in SCOP 1.55, called d2chy__
  
• d2chya_ appears in SCOPe 2.07