| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.1: CheY-like [52172] (8 families) ![]() |
| Family c.23.1.1: CheY-related [52173] (26 proteins) |
| Protein CheY protein [52174] (6 species) |
| Species Escherichia coli [TaxId:562] [52175] (42 PDB entries) Uniprot P06143 |
| Domain d1cyea_: 1cye A: [31077] |
PDB Entry: 1cye (more details)
SCOPe Domain Sequences for d1cyea_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cyea_ c.23.1.1 (A:) CheY protein {Escherichia coli [TaxId: 562]}
rsdkelkflvvddfstmrrivrnllkelgfnnveeaedgvdalnklqaggygfvisdwnm
pnmdglellktiradgamsalpvlmvtaeakkeniiaaaqagasgyvvkpftaatleekl
nkifeklgm
Timeline for d1cyea_: