Lineage for d1cye__ (1cye -)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 21773Fold c.23: Flavodoxin-like [52171] (16 superfamilies)
  4. 21774Superfamily c.23.1: CheY-like [52172] (3 families) (S)
  5. 21775Family c.23.1.1: CheY-related [52173] (9 proteins)
  6. 21776Protein CheY protein [52174] (3 species)
  7. 21777Species Escherichia coli [TaxId:562] [52175] (24 PDB entries)
  8. 21817Domain d1cye__: 1cye - [31077]

Details for d1cye__

PDB Entry: 1cye (more details)

PDB Description: three dimensional structure of chemotactic che y protein in aqueous solution by nuclear magnetic resonance methods

SCOP Domain Sequences for d1cye__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cye__ c.23.1.1 (-) CheY protein {Escherichia coli}
rsdkelkflvvddfstmrrivrnllkelgfnnveeaedgvdalnklqaggygfvisdwnm
pnmdglellktiradgamsalpvlmvtaeakkeniiaaaqagasgyvvkpftaatleekl
nkifeklgm

SCOP Domain Coordinates for d1cye__:

Click to download the PDB-style file with coordinates for d1cye__.
(The format of our PDB-style files is described here.)

Timeline for d1cye__: