SCOPe 2.08: Domain d5fiub2: 5fiu B:193-298

Lineage for d5fiub2 (5fiu B:193-298)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.141: Bacterial fluorinating enzyme, C-terminal domain [101851] (1 superfamily)
   barrel, closed; n=7, S=10; greek-key topology; one overside connection

4. Superfamily b.141.1: Bacterial fluorinating enzyme, C-terminal domain [101852] (2 families)

5. Family b.141.1.1: Bacterial fluorinating enzyme, C-terminal domain [101853] (1 protein)

6. Protein 5'-fluoro-5'-deoxyadenosine synthase [101854] (1 species)

7. Species Streptomyces cattleya [TaxId:29303] [101855] (12 PDB entries)

8. Domain d5fiub2: 5fiu B:193-298 [310546]
   Other proteins in same PDB: d5fiua1, d5fiub1, d5fiuc1
   automated match to d1rqpa1
   complexed with tla, y3j

Details for d5fiub2

PDB Entry: 5fiu, 1.84 Å

PDB Description: binding and structural studies of a 5,5-difluoromethyl adenosine nucleoside with the fluorinase enzyme

PDB Compounds: (B:) 5'-fluoro-5'-deoxy-adenosine synthase

SCOPe Domain Sequences for d5fiub2:

Sequence; same for both SEQRES and ATOM records:

>d5fiub2 b.141.1.1 (B:193-298) 5'-fluoro-5'-deoxyadenosine synthase {Streptomyces cattleya [TaxId: 29303]}
paveqdgealvgvvsaidhpfgnvwtnihrtdlekagigygarlrltldgvlpfeapltp
tfadageigniaiylnsrgylsiarnaaslaypyhlkegmsarvea

Timeline for d5fiub2:

• d5fiub2 first appeared in SCOPe 2.06
  
• d5fiub2 appears in SCOPe 2.07