Lineage for d5ctnb_ (5ctn B:)

  1. Root: SCOPe 2.07
  2. 2618030Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)
  3. 2618349Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 2618350Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 2619748Family e.3.1.0: automated matches [191512] (1 protein)
    not a true family
  6. 2619749Protein automated matches [190857] (70 species)
    not a true protein
  7. 2619928Species Bacillus pumilus [TaxId:1408] [279437] (2 PDB entries)
  8. 2619932Domain d5ctnb_: 5ctn B: [310356]
    automated match to d5ctma_
    complexed with 5r7, flc

Details for d5ctnb_

PDB Entry: 5ctn (more details), 1.35 Å

PDB Description: structure of bpu1 beta-lactamase
PDB Compounds: (B:) Beta-lactamase

SCOPe Domain Sequences for d5ctnb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ctnb_ e.3.1.0 (B:) automated matches {Bacillus pumilus [TaxId: 1408]}
siawsvdeffknregtfviqevkekspwvynkkrakerfapqstfkvanaliglqtgavr
deydikywdgvkreidnwnrdhtlgsgmrdsvvwyyqamardigeermnhwvkaihygnk
disggidqfwlsstlrispieqvrflkqlyeetlpfdlknmrtvkrmmvqeeekhatlyg
ktgsgsdigwyvgfikhehktyilatnikgtgieakdityrilkkyhlmeas

SCOPe Domain Coordinates for d5ctnb_:

Click to download the PDB-style file with coordinates for d5ctnb_.
(The format of our PDB-style files is described here.)

Timeline for d5ctnb_: