Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.20: Initiation factor IF2/eIF5b, domain 3 [52155] (1 superfamily) 3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 2134 |
Superfamily c.20.1: Initiation factor IF2/eIF5b, domain 3 [52156] (1 family) |
Family c.20.1.1: Initiation factor IF2/eIF5b, domain 3 [52157] (1 protein) |
Protein Initiation factor IF2/eIF5b, domain 3 [52158] (1 species) |
Species Methanobacterium thermoautotrophicum [TaxId:145262] [52159] (3 PDB entries) |
Domain d1g7ta3: 1g7t A:329-459 [31033] Other proteins in same PDB: d1g7ta1, d1g7ta2, d1g7ta4 complexed with gnp, mg |
PDB Entry: 1g7t (more details), 2 Å
SCOPe Domain Sequences for d1g7ta3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1g7ta3 c.20.1.1 (A:329-459) Initiation factor IF2/eIF5b, domain 3 {Methanobacterium thermoautotrophicum [TaxId: 145262]} dpekvreeilseiedikidtdeagvvvkadtlgsleavvkilrdmyvpikvadigdvsrr dvvnagialqedrvygaiiafnvkvipsaaqelknsdiklfqgnviyrlmeeyeewvrgi eeekkkkwmea
Timeline for d1g7ta3: