SCOPe 2.07: Domain d5agya1: 5agy A:3-83

Lineage for d5agya1 (5agy A:3-83)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.0: automated matches [191312] (1 protein)
   not a true family

6. Protein automated matches [190056] (188 species)
   not a true protein

7. Species Soybean (Glycine max) [TaxId:3847] [225579] (5 PDB entries)

8. Domain d5agya1: 5agy A:3-83 [310158]
   Other proteins in same PDB: d5agya2, d5agya3, d5agyb2
   automated match to d4chsb1
   complexed with 4nm, gtb, po4; mutant

Details for d5agya1

PDB Entry: 5agy, 1.75 Å

PDB Description: crystal structure of a tau class gst mutant from glycine

PDB Compounds: (A:) glutathione s-transferase

SCOPe Domain Sequences for d5agya1:

Sequence; same for both SEQRES and ATOM records:

>d5agya1 c.47.1.0 (A:3-83) automated matches {Soybean (Glycine max) [TaxId: 3847]}
devvlldfwpspfgmrvrialaekgikyeykeedlqnksplllkmnpvhkkipvlihngk
picesliavqyieevwndrnp

Timeline for d5agya1:

• d5agya1 first appeared in SCOPe 2.06
  
• d5agya1 appears in the current release, SCOPe 2.08