SCOPe 2.03: Domain d1udha_: 1udh A:

Lineage for d1udha_ (1udh A:)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.18: Uracil-DNA glycosylase-like [52140] (1 superfamily)
   3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 2134

4. Superfamily c.18.1: Uracil-DNA glycosylase-like [52141] (5 families)

5. Family c.18.1.1: Uracil-DNA glycosylase [52142] (2 proteins)

6. Protein Uracil-DNA glycosylase [52143] (5 species)

7. Species Herpes simplex virus type 1 [TaxId:10298] [52145] (4 PDB entries)

8. Domain d1udha_: 1udh A: [31015]
   complexed with so4, ura

Details for d1udha_

PDB Entry: 1udh, 1.75 Å

PDB Description: the structural basis of specific base excision repair by uracil-dna glycosylase

PDB Compounds: (A:) uracil-DNA glycosylase

SCOPe Domain Sequences for d1udha_:

Sequence; same for both SEQRES and ATOM records:

>d1udha_ c.18.1.1 (A:) Uracil-DNA glycosylase {Herpes simplex virus type 1 [TaxId: 10298]}
ldwttfrrvfliddawrplmepelanpltahllaeynrrcqteevlppredvfswtryct
pdevrvviigqdpyhhpgqahglafsvranvppppslrnvlaavkncypearmsghgcle
kwardgvlllnttltvkrgaaashsrigwdrfvggvirrlaarrpglvfmlwgthaqnai
rpdprvhcvlkfshpsplskvpfgtcqhflvanryletrsispidwsv

Timeline for d1udha_:

• d1udha_ first appeared (with stable ids) in SCOP 1.55, called d1udh__
  
• d1udha_ appears in SCOPe 2.02
  
• d1udha_ appears in SCOPe 2.04
  
• d1udha_ appears in the current release, SCOPe 2.08