Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.165: Ribosome inactivating proteins (RIP) [56370] (1 superfamily) contains mixed beta-sheet |
Superfamily d.165.1: Ribosome inactivating proteins (RIP) [56371] (3 families) |
Family d.165.1.1: Plant cytotoxins [56372] (18 proteins) |
Protein automated matches [190420] (8 species) not a true protein |
Species Momordica balsamina [TaxId:3672] [189375] (74 PDB entries) |
Domain d4zuqa_: 4zuq A: [310127] automated match to d4zuoa_ complexed with 6xa, gol, k, na, zn |
PDB Entry: 4zuq (more details), 1.22 Å
SCOPe Domain Sequences for d4zuqa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4zuqa_ d.165.1.1 (A:) automated matches {Momordica balsamina [TaxId: 3672]} mrvifsedhklrnaktelyggelvppfeapfraewilaavkeagfddvvaparhgletvl kvhdagylnfletawdrwkaagykgeaiatsfpvrrtspriptdiegqigyycnaaetai spgtweaalssmasaidgadliaaghkaafslcrppghhagidmfggycfinnaavaaqr lldkgakkiaildvdfhhgngtqdifyergdvffaslhgdpaeafphflgyaeetgkgag agttanypmgrgtpysvwgealtdslkriaafgaeaivvslgvdtfeqdpisffkltspd yitmgrtiaasgvpllvvmeggygvpeiglnvanvlkgvag
Timeline for d4zuqa_: