Lineage for d4yi8a_ (4yi8 A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1996349Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 1996350Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 1996818Family a.39.1.5: Calmodulin-like [47502] (24 proteins)
    Duplication: made with two pairs of EF-hands
  6. 1997383Protein automated matches [190064] (21 species)
    not a true protein
  7. 1997406Species Cow (Bos taurus) [TaxId:9913] [228970] (3 PDB entries)
  8. 1997407Domain d4yi8a_: 4yi8 A: [310104]
    automated match to d2d8na_
    complexed with ca, so4

Details for d4yi8a_

PDB Entry: 4yi8 (more details), 1.2 Å

PDB Description: crystal structure of non-myristoylated e153a recoverin at 1.2 a resolution with calcium ions bound to ef-hands 2 and 3
PDB Compounds: (A:) Recoverin

SCOPe Domain Sequences for d4yi8a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4yi8a_ a.39.1.5 (A:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
galskeileelqlntkfteeelsswyqsflkecpsgritrqefqtiyskffpeadpkaya
qhvfrsfdansdgtldfkeyvialhmtsagktnqklewafslydvdgngtisknevleiv
taifkmispedtkhlpedentpekraakiwgffgkkdddkltekefiegtlankeilrli
qfepqkvkekl

SCOPe Domain Coordinates for d4yi8a_:

Click to download the PDB-style file with coordinates for d4yi8a_.
(The format of our PDB-style files is described here.)

Timeline for d4yi8a_: