Lineage for d4xyha_ (4xyh A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2065823Fold b.69: 7-bladed beta-propeller [50964] (15 superfamilies)
    consists of seven 4-stranded beta-sheet motifs; meander
  4. 2065971Superfamily b.69.4: WD40 repeat-like [50978] (4 families) (S)
    also contains 8-bladed propellers
  5. 2066122Family b.69.4.0: automated matches [191412] (1 protein)
    not a true family
  6. 2066123Protein automated matches [190568] (6 species)
    not a true protein
  7. 2066234Species Schizosaccharomyces japonicus [TaxId:402676] [311483] (1 PDB entry)
  8. 2066235Domain d4xyha_: 4xyh A: [310089]
    automated match to d3c9ca_

Details for d4xyha_

PDB Entry: 4xyh (more details), 2.3 Å

PDB Description: wild-type full length mis16 in schizosaccharomyces japonicus
PDB Compounds: (A:) Kinetochore protein Mis16

SCOPe Domain Sequences for d4xyha_:

Sequence, based on SEQRES records: (download)

>d4xyha_ b.69.4.0 (A:) automated matches {Schizosaccharomyces japonicus [TaxId: 402676]}
lsevdlekkiqeeyklwkqnvpflydlvitealewpsltvewfpgsersladnssiqkll
lgtqtsgndqnylqvasvqlptfdddlddltpskmkpanfkgdygldivqkihhegdvnk
arfmpqnpdiiatlglngngyifdlnlyreqpivqtghqaclrhhtsegfglgwnfiqeg
tlatgtedtsicvwdikgkslsleksidvapvsvyhrhtavvndlqfhlqhealltsvsd
dctlqihdtrlpssssasqcvkaheqpvngvafnpfndyllatasadhtvalwdlrrlnq
rlhtleghedevynvqwsphdepilvtsstdrrvcvwdlskigeeqtvedsedgapelmf
mhgghtnrvsdlswnpnnkwvlasladdnilqiwspskviwa

Sequence, based on observed residues (ATOM records): (download)

>d4xyha_ b.69.4.0 (A:) automated matches {Schizosaccharomyces japonicus [TaxId: 402676]}
lsevdlekkiqeeyklwkqnvpflydlvitealewpsltvewfpgsednssiqklllgtq
tsgndqnylqvasvqlptldivqkihhegdvnkarfmpqnpdiiatlglngngyifdlnl
yreqpivqtghqaclrhhtsegfglgwnfiqegtlatgtedtsicvwdikgkslsleksi
dvapvsvyhrhtavvndlqfhlqhealltsvsddctlqihdtrlpssssasqcvkaheqp
vngvafnpfndyllatasadhtvalwdlrrlnqrlhtleghedevynvqwsphdepilvt
sstdrrvcvwdlskigeeqtvedsedgapelmfmhgghtnrvsdlswnpnnkwvlaslad
dnilqiwspskviwa

SCOPe Domain Coordinates for d4xyha_:

Click to download the PDB-style file with coordinates for d4xyha_.
(The format of our PDB-style files is described here.)

Timeline for d4xyha_:

  • d4xyha_ is new in SCOPe 2.06-stable