Class b: All beta proteins [48724] (178 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
Protein automated matches [190119] (22 species) not a true protein |
Species Vicugna pacos [TaxId:30538] [189756] (79 PDB entries) |
Domain d4x7fd1: 4x7f D:1-111 [309972] Other proteins in same PDB: d4x7fc2, d4x7fd2 automated match to d4x7dd_ complexed with edo, imd, na, po4 |
PDB Entry: 4x7f (more details), 1.7 Å
SCOPe Domain Sequences for d4x7fd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4x7fd1 b.1.1.1 (D:1-111) automated matches {Vicugna pacos [TaxId: 30538]} dvqlvesggglvqpggslrlscaasesilsfnhmawyrqgpgeqrelvavitregstdya dsvkgrftisrdnaknmvyllmsnlrpedtavyycnrgisnpwgqgtqvtv
Timeline for d4x7fd1: