SCOPe 2.07: Domain d4x7fd1: 4x7f D:1-111

Lineage for d4x7fd1 (4x7f D:1-111)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (22 species)
   not a true protein

7. Species Vicugna pacos [TaxId:30538] [189756] (79 PDB entries)

8. Domain d4x7fd1: 4x7f D:1-111 [309972]
   Other proteins in same PDB: d4x7fc2, d4x7fd2
   automated match to d4x7dd_
   complexed with edo, imd, na, po4

Details for d4x7fd1

PDB Entry: 4x7f, 1.7 Å

PDB Description: crystal structure of norovirus gii.10 p domain in complex with nano-25

PDB Compounds: (D:) Nano-25 Nanobody

SCOPe Domain Sequences for d4x7fd1:

Sequence; same for both SEQRES and ATOM records:

>d4x7fd1 b.1.1.1 (D:1-111) automated matches {Vicugna pacos [TaxId: 30538]}
dvqlvesggglvqpggslrlscaasesilsfnhmawyrqgpgeqrelvavitregstdya
dsvkgrftisrdnaknmvyllmsnlrpedtavyycnrgisnpwgqgtqvtv

Timeline for d4x7fd1:

• d4x7fd1 first appeared in SCOPe 2.06, called d4x7fd_
  
• d4x7fd1 appears in the current release, SCOPe 2.08