SCOPe 2.08: Domain d4wloc2: 4wlo C:169-337

Lineage for d4wloc2 (4wlo C:169-337)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
   unusual fold, defines family

4. Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families)

5. Family d.162.1.1: Lactate & malate dehydrogenases, C-terminal domain [56328] (5 proteins)
   N-terminal domain is NAD-binding module (alpha/beta Rossmann-fold domain)
   automatically mapped to Pfam PF02866

6. Protein automated matches [226882] (10 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [225057] (9 PDB entries)

8. Domain d4wloc2: 4wlo C:169-337 [309886]
   Other proteins in same PDB: d4wloa1, d4wlob1, d4wloc1, d4wlod1
   automated match to d2dfda2
   complexed with nai, oaa

Details for d4wloc2

PDB Entry: 4wlo, 2.5 Å

PDB Description: crystal structure of oxaloacetate and nadh bound mdh2

PDB Compounds: (C:) Malate dehydrogenase, mitochondrial

SCOPe Domain Sequences for d4wloc2:

Sequence; same for both SEQRES and ATOM records:

>d4wloc2 d.162.1.1 (C:169-337) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vttldivrantfvaelkgldparvnvpvigghagktiiplisqctpkvdfpqdqltaltg
riqeagtevvkakagagsatlsmayagarfvfslvdamngkegvvecsfvksqetectyf
stplllgkkgieknlgigkvssfeekmisdaipelkasikkgedfvktl

Timeline for d4wloc2:

• d4wloc2 first appeared in SCOPe 2.06
  
• d4wloc2 appears in SCOPe 2.07