SCOPe 2.08: Domain d4wlnd2: 4wln D:169-337

Lineage for d4wlnd2 (4wln D:169-337)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
   unusual fold, defines family

4. Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families)

5. Family d.162.1.1: Lactate & malate dehydrogenases, C-terminal domain [56328] (5 proteins)
   N-terminal domain is NAD-binding module (alpha/beta Rossmann-fold domain)
   automatically mapped to Pfam PF02866

6. Protein automated matches [226882] (10 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [225057] (9 PDB entries)

8. Domain d4wlnd2: 4wln D:169-337 [309880]
   Other proteins in same PDB: d4wlna1, d4wlnb1, d4wlnc1, d4wlnd1
   automated match to d2dfda2
   complexed with po4

Details for d4wlnd2

PDB Entry: 4wln, 2.28 Å

PDB Description: crystal structure of apo mdh2

PDB Compounds: (D:) Malate dehydrogenase, mitochondrial

SCOPe Domain Sequences for d4wlnd2:

Sequence; same for both SEQRES and ATOM records:

>d4wlnd2 d.162.1.1 (D:169-337) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vttldivrantfvaelkgldparvnvpvigghagktiiplisqctpkvdfpqdqltaltg
riqeagtevvkakagagsatlsmayagarfvfslvdamngkegvvecsfvksqetectyf
stplllgkkgieknlgigkvssfeekmisdaipelkasikkgedfvktl

Timeline for d4wlnd2:

• d4wlnd2 first appeared in SCOPe 2.06
  
• d4wlnd2 appears in SCOPe 2.07