Lineage for d4wa5a_ (4wa5 A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2417088Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies)
    consists of six 4-stranded beta-sheet motifs; meander
  4. 2417089Superfamily b.68.1: Sialidases [50939] (3 families) (S)
  5. 2417611Family b.68.1.0: automated matches [191452] (1 protein)
    not a true family
  6. 2417612Protein automated matches [190692] (20 species)
    not a true protein
  7. 2417643Species Influenza A virus (a/harbor seal/massachusetts/1/2011(h3n8)) [TaxId:1136533] [311454] (3 PDB entries)
  8. 2417646Domain d4wa5a_: 4wa5 A: [309818]
    automated match to d4qn5a_
    complexed with ca, zmr

Details for d4wa5a_

PDB Entry: 4wa5 (more details), 1.95 Å

PDB Description: the crystal structure of neuraminidase from a h3n8 influenza virus isolated from new england harbor seals in complex with zanamivir
PDB Compounds: (A:) Neuraminidase

SCOPe Domain Sequences for d4wa5a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4wa5a_ b.68.1.0 (A:) automated matches {Influenza A virus (a/harbor seal/massachusetts/1/2011(h3n8)) [TaxId: 1136533]}
qfmqntealcdvkgfapfskdngirigsrghvfvirepfvscsptecrtffltqgsllnd
khsngtekdrspyrtlmsveigqspnvyqarfeavawsatachdgkkwmtigvtgpdaka
vavvhyggiptdvinswagdilrtqessctcilgecywvmtdgpanrqaqyrafkakqgk
iigqveisfngghieecscypndgkvecvcrdnwtgtnrpvlvispdlsyrvgylcagls
sdtprgedsqftgsctspvgnqgygvkgfgfrqgndvwmgrtisrtsrsgfeilkvrngw
vqtskeqikrqvvvdnlnrsgysgsftlpveltkrdclvpcfwvemirgkpaektiwtss
ssivmcgvdhevadwswhdgailpfdid

SCOPe Domain Coordinates for d4wa5a_:

Click to download the PDB-style file with coordinates for d4wa5a_.
(The format of our PDB-style files is described here.)

Timeline for d4wa5a_: