Lineage for d4uk2g_ (4uk2 G:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2808719Fold b.69: 7-bladed beta-propeller [50964] (15 superfamilies)
    consists of seven 4-stranded beta-sheet motifs; meander
  4. 2808917Superfamily b.69.4: WD40 repeat-like [50978] (4 families) (S)
    also contains 8-bladed propellers
  5. 2809156Family b.69.4.0: automated matches [191412] (1 protein)
    not a true family
  6. 2809157Protein automated matches [190568] (11 species)
    not a true protein
  7. 2809172Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [267880] (22 PDB entries)
  8. 2809185Domain d4uk2g_: 4uk2 G: [309730]
    automated match to d3frxd_
    protein/RNA complex; complexed with anm, mg, ohx, zn

Details for d4uk2g_

PDB Entry: 4uk2 (more details), 3 Å

PDB Description: Crystal structure of Anisomycin bound to the yeast 80S ribosome
PDB Compounds: (G:) Guanine nucleotide-binding protein subunit beta-like protein

SCOPe Domain Sequences for d4uk2g_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4uk2g_ b.69.4.0 (G:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
asnevlvlrgtleghngwvtslatsagqpnlllsasrdktliswkltgddqkfgvpvrsf
kghshivqdctltadgayalsaswdktlrlwdvatgetyqrfvghksdvmsvdidkkasm
iisgsrdktikvwtikgqclatllghndwvsqvrvvpnekadddsvtiisagndkmvkaw
nlnqfqieadfighnsnintltaspdgtliasagkdgeimlwnlaakkamytlsaqdevf
slafspnrywlaaatatgikvfsldpqylvddlrpefagyskaaephavslawsadgqtl
fagytdnvirvwqvmtan

SCOPe Domain Coordinates for d4uk2g_:

Click to download the PDB-style file with coordinates for d4uk2g_.
(The format of our PDB-style files is described here.)

Timeline for d4uk2g_: