Lineage for d4ujsg_ (4ujs G:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2808719Fold b.69: 7-bladed beta-propeller [50964] (15 superfamilies)
    consists of seven 4-stranded beta-sheet motifs; meander
  4. 2808917Superfamily b.69.4: WD40 repeat-like [50978] (4 families) (S)
    also contains 8-bladed propellers
  5. 2809156Family b.69.4.0: automated matches [191412] (1 protein)
    not a true family
  6. 2809157Protein automated matches [190568] (11 species)
    not a true protein
  7. 2809172Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [267880] (22 PDB entries)
  8. 2809181Domain d4ujsg_: 4ujs G: [309726]
    automated match to d3frxd_
    protein/RNA complex; complexed with 3h3, mg, ohx, zn

Details for d4ujsg_

PDB Entry: 4ujs (more details), 2.8 Å

PDB Description: Crystal structure of Lactimidomycin bound to the yeast 80S ribosome
PDB Compounds: (G:) Guanine nucleotide-binding protein subunit beta-like protein

SCOPe Domain Sequences for d4ujsg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ujsg_ b.69.4.0 (G:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
asnevlvlrgtleghngwvtslatsagqpnlllsasrdktliswkltgddqkfgvpvrsf
kghshivqdctltadgayalsaswdktlrlwdvatgetyqrfvghksdvmsvdidkkasm
iisgsrdktikvwtikgqclatllghndwvsqvrvvpnekadddsvtiisagndkmvkaw
nlnqfqieadfighnsnintltaspdgtliasagkdgeimlwnlaakkamytlsaqdevf
slafspnrywlaaatatgikvfsldpqylvddlrpefagyskaaephavslawsadgqtl
fagytdnvirvwqvmtan

SCOPe Domain Coordinates for d4ujsg_:

Click to download the PDB-style file with coordinates for d4ujsg_.
(The format of our PDB-style files is described here.)

Timeline for d4ujsg_: