Class b: All beta proteins [48724] (180 folds) |
Fold b.69: 7-bladed beta-propeller [50964] (15 superfamilies) consists of seven 4-stranded beta-sheet motifs; meander |
Superfamily b.69.4: WD40 repeat-like [50978] (4 families) also contains 8-bladed propellers |
Family b.69.4.0: automated matches [191412] (1 protein) not a true family |
Protein automated matches [190568] (11 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [267880] (22 PDB entries) |
Domain d4ujsg_: 4ujs G: [309726] automated match to d3frxd_ protein/RNA complex; complexed with 3h3, mg, ohx, zn |
PDB Entry: 4ujs (more details), 2.8 Å
SCOPe Domain Sequences for d4ujsg_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ujsg_ b.69.4.0 (G:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]} asnevlvlrgtleghngwvtslatsagqpnlllsasrdktliswkltgddqkfgvpvrsf kghshivqdctltadgayalsaswdktlrlwdvatgetyqrfvghksdvmsvdidkkasm iisgsrdktikvwtikgqclatllghndwvsqvrvvpnekadddsvtiisagndkmvkaw nlnqfqieadfighnsnintltaspdgtliasagkdgeimlwnlaakkamytlsaqdevf slafspnrywlaaatatgikvfsldpqylvddlrpefagyskaaephavslawsadgqtl fagytdnvirvwqvmtan
Timeline for d4ujsg_: